PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930849.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GATA
Protein Properties Length: 187aa    MW: 21149.9 Da    PI: 8.2922
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930849.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.8e-18112146135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C +C +t+Tp+WR gp g+ tLCnaCG+++++ +l
  XP_010930849.1 112 CIHCLATDTPQWRAGPAGPGTLCNACGIRFKSGRL 146
                     99*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.8E-14106160IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.044106142IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.33E-14108169No hitNo description
Gene3DG3DSA:3.30.50.103.9E-14110144IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.27E-13111161No hitNo description
PROSITE patternPS003440112137IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15112146IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MTLSHRVFQS LYLDESLEPD TEDPAEEELA VPNDPLDELD WQTPLFGDVT NMLRSLPTPK  60
RTQNNDVLDL RREICTKRVP RKPRRQCSGR RIWSLEPPTL SCSGARENSR SCIHCLATDT  120
PQWRAGPAGP GTLCNACGIR FKSGRLLPQY RPSTSPTFKG RLHSNRHKKV MKIREQSGDA  180
DIADLDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930849.11e-137PREDICTED: GATA transcription factor 7-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-32GATA transcription factor 7